Return to main results Retrieve Phyre Job Id

Job DescriptionP31801
Confidence2.57%DateThu Jan 5 11:48:41 GMT 2012
Rank26Aligned Residues24
% Identity21%Templatec3llbA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein; PDBTitle: the crystal structure of the protein pa3983 with unknown2 function from pseudomonas aeruginosa pao1
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   62....... 70.........80.....
Predicted Secondary structure 
........

Query SS confidence 







. . . . . . . .















Query Sequence  DVLAHRLG. . . . . . . . EPYGSLILSLSVVILE
Query Conservation 
 

   
........   
 

 
     

Alig confidence 







........















Template Conservation   

       
      

 
 
   

 

 
Template Sequence  DAFNDFFGSEFSDEEFDTVGGLVMSAFGHLPK
Template Known Secondary structure 




TTT
SBSS


Template Predicted Secondary structure 















Template SS confidence 































   20.........30.........40.........50.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions