Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8G6
Confidence83.76%DateThu Jan 5 11:07:47 GMT 2012
Rank107Aligned Residues54
% Identity15%Templated1iiba_
SCOP infoPhosphotyrosine protein phosphatases I-like PTS system IIB component-like PTS system, Lactose/Cellobiose specific IIB subunit
Resolution1.80

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50.........60.........70.....
Predicted Secondary structure 




























Query SS confidence 









































































Query Sequence  AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFG
Query Conservation   




  
  


  

  
  
     
 

    
                          
  

 



Alig confidence 










.















.









..................
















Template Conservation 




 
  
 .


 
  

   
   .     
 
  ..................           




 
Template Sequence  KHIYLFSSAGM. STSLLVSKMRAQAEKY. EVPVIIEAFP. . . . . . . . . . . . . . . . . . ETLAGEKGQNADVVLLG
Template Known Secondary structure  S
.T.T

..................GGGTT
S
Template Predicted Secondary structure 




.

.


..................




Template SS confidence 









































































   4.....10.... .....20.........30 .........40 .........50.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions