Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8G6
Confidence28.72%DateThu Jan 5 11:07:47 GMT 2012
Rank372Aligned Residues47
% Identity15%Templatec3fijD_
PDB info PDB header:structural genomics, unknown functionChain: D: PDB Molecule:lin1909 protein; PDBTitle: crystal structure of a uncharacterized protein lin1909
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.........70....
Predicted Secondary structure 





























Query SS confidence 









































































Query Sequence  MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIF
Query Conservation 
 




  
  


  

  
  
     
 

    
                          
  

 


Alig confidence 









.........









.










.................















Template Conservation 






   ......... 

   
  
.

  
 
    .................       
   




Template Sequence  LKPVIGITGQ. . . . . . . . . QRYVDAIQKV. GGFPIALPIDD. . . . . . . . . . . . . . . . . PSTAVQAISLVDGLLL
Template Known Secondary structure 




.........T.T




.................GGGT
S
Template Predicted Secondary structure 



.........
.





.................

Template SS confidence 









































































   3......10.. .......20.. .......30... ......40.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions