Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6U8
Confidence68.18%DateThu Jan 5 11:03:56 GMT 2012
Rank288Aligned Residues30
% Identity17%Templated1wl8a1
SCOP infoFlavodoxin-like Class I glutamine amidotransferase-like Class I glutamine amidotransferases (GAT)
Resolution1.45

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40
Predicted Secondary structure 













Query SS confidence 







































Query Sequence  MQVLHVCSEMFPLLKTGGLADVIGALPAAQIADGVDARVL
Query Conservation 



 
     
    

       

  
   

 
 

Alig confidence 







........

..



















Template Conservation 
 




 ........  ..     
   
   
    

Template Sequence  MMIVIMDN. . . . . . . . GG. . QYVHRIWRTLRYLGVETKII
Template Known Secondary structure 

........S
..TTTT
Template Predicted Secondary structure 

........

..



Template SS confidence 







































   1....... .10 .........20.........30
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions