Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6U8
Confidence59.93%DateThu Jan 5 11:03:56 GMT 2012
Rank413Aligned Residues35
% Identity9%Templatec3tqqA_
PDB info PDB header:transferaseChain: A: PDB Molecule:methionyl-trna formyltransferase; PDBTitle: structure of the methionyl-trna formyltransferase (fmt) from coxiella2 burnetii
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40......
Predicted Secondary structure 


















Query SS confidence 













































Query Sequence  MQVLHVCSEMFPLLKTGGLADVIGALPAAQIADGVDARVLLPAFPD
Query Conservation 



 
     
    

       

  
   

 
 


     
Alig confidence 





...........




























Template Conservation 



  ...........

       
  
      
  


 
  
Template Sequence  LKIVFA. . . . . . . . . . . GTPQFAVPTLRALIDSSHRVLAVYTQPDE
Template Known Secondary structure 
...........
SGGGSSS




Template Predicted Secondary structure 
...........










Template SS confidence 













































   3..... .10.........20.........30.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions