Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6U8
Confidence57.74%DateThu Jan 5 11:03:56 GMT 2012
Rank450Aligned Residues29
% Identity7%Templatec3oc4A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:oxidoreductase, pyridine nucleotide-disulfide family; PDBTitle: crystal structure of a pyridine nucleotide-disulfide family2 oxidoreductase from the enterococcus faecalis v583
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30... ......40
Predicted Secondary structure 











..

Query SS confidence 
































. .






Query Sequence  MQVLHVCSEMFPLLKTGGLADVIGALPAAQIAD. . GVDARVL
Query Conservation 



 
     
    

       

  
   ..

 
 

Alig confidence 





...........















..






Template Conservation 





...........


 





  
 
      
 

Template Sequence  LKIVII. . . . . . . . . . . GASFAGISAAIASRKKYPQAEISLI
Template Known Secondary structure 
...........

S
SSS
Template Predicted Secondary structure 
...........






Template SS confidence 









































  
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions