Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6U8
Confidence74.55%DateThu Jan 5 11:03:56 GMT 2012
Rank216Aligned Residues32
% Identity13%Templatec3ic5A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:putative saccharopine dehydrogenase; PDBTitle: n-terminal domain of putative saccharopine dehydrogenase from ruegeria2 pomeroyi.
Resolution2.08 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.... .....40...
Predicted Secondary structure 












.


Query SS confidence 

































.








Query Sequence  MQVLHVCSEMFPLLKTGGLADVIGALPAAQIADG. VDARVLLPA
Query Conservation 



 
     
    

       

  
   
.
 
 


  
Alig confidence 





..........

.














.








Template Conservation 


 

..........
 .
 

      
       
      
Template Sequence  WNICVV. . . . . . . . . . GA. GKIGQXIAALLKTSSNYSVTVADHD
Template Known Secondary structure  ..........

.S
SSS
Template Predicted Secondary structure  ..........

.






Template SS confidence 











































   3..... .10 .........20.........30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions