Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6U8
Confidence91.04%DateThu Jan 5 11:03:56 GMT 2012
Rank103Aligned Residues32
% Identity16%Templatec3g0oA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:3-hydroxyisobutyrate dehydrogenase; PDBTitle: crystal structure of 3-hydroxyisobutyrate dehydrogenase2 (ygbj) from salmonella typhimurium
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40...
Predicted Secondary structure 















Query SS confidence 










































Query Sequence  MQVLHVCSEMFPLLKTGGLADVIGALPAAQIADGVDARVLLPA
Query Conservation 



 
     
    

       

  
   

 
 


  
Alig confidence 





...........

























Template Conservation 





...........
 
 

  

  
   
  
   
  
Template Sequence  FHVGIV. . . . . . . . . . . GLGSXGXGAARSCLRAGLSTWGADLN
Template Known Secondary structure 
...........

STT

S
Template Predicted Secondary structure 
...........









Template SS confidence 










































   7..10.. .......20.........30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions