Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6U8
Confidence58.54%DateThu Jan 5 11:03:56 GMT 2012
Rank438Aligned Residues29
% Identity10%Templatec3fbsB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:oxidoreductase; PDBTitle: the crystal structure of the oxidoreductase from agrobacterium2 tumefaciens
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1. .......10.........20.........30.........40
Predicted Secondary structure 
..












Query SS confidence 

. .





































Query Sequence  MQ. . VLHVCSEMFPLLKTGGLADVIGALPAAQIADGVDARVL
Query Conservation 

..

 
     
    

       

  
   

 
 

Alig confidence 

..



...........






















Template Conservation 
 





...........






 

  

  
  
 

Template Sequence  MKFDVIII. . . . . . . . . . . GGSYAGLSAALQLGRARKNILLV
Template Known Secondary structure 

...........

STT

Template Predicted Secondary structure 



...........





Template SS confidence 









































   1....... .10.........20.........30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions