Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6U8
Confidence80.70%DateThu Jan 5 11:03:56 GMT 2012
Rank175Aligned Residues29
% Identity24%Templatec3eywA_
PDB info PDB header:transport proteinChain: A: PDB Molecule:c-terminal domain of glutathione-regulated potassium-efflux PDBTitle: crystal structure of the c-terminal domain of e. coli kefc in complex2 with keff
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40
Predicted Secondary structure 













Query SS confidence 







































Query Sequence  MQVLHVCSEMFPLLKTGGLADVIGALPAAQIADGVDARVL
Query Conservation 



 
     
    

       

  
   

 
 

Alig confidence 





...........






















Template Conservation 




 ...........
 




 


 
   
  



Template Sequence  MRVIIA. . . . . . . . . . . GFGRFGQITGRLLLSSGVKMVVL
Template Known Secondary structure 

...........

STT

Template Predicted Secondary structure 
...........






Template SS confidence 







































   400..... ....410.........420........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions