Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6U8
Confidence83.53%DateThu Jan 5 11:03:56 GMT 2012
Rank154Aligned Residues34
% Identity29%Templatec3c7cB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:octopine dehydrogenase; PDBTitle: a structural basis for substrate and stereo selectivity in2 octopine dehydrogenase (odh-nadh-l-arginine)
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30... ......40.....
Predicted Secondary structure 











.





Query SS confidence 
































.











Query Sequence  MQVLHVCSEMFPLLKTGGLADVIGALPAAQIAD. GVDARVLLPAFP
Query Conservation 



 
     
    

       

  
   .

 
 


    
Alig confidence 





...........















.











Template Conservation 


 

...........



 
 


  

   
  
 
      
Template Sequence  VKVCVC. . . . . . . . . . . GGGNGAHTLSGLAASRDGVEVRVLTLFAD
Template Known Secondary structure  ...........

STTSTT

STT
Template Predicted Secondary structure 
...........








Template SS confidence 













































   3..... .10.........20.........30.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions