Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6U8
Confidence81.08%DateThu Jan 5 11:03:56 GMT 2012
Rank172Aligned Residues33
% Identity12%Templatec2vrcD_
PDB info PDB header:oxidoreductaseChain: D: PDB Molecule:triphenylmethane reductase; PDBTitle: crystal structure of the citrobacter sp. triphenylmethane2 reductase complexed with nadp(h)
Resolution2.5 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30... ......40...
Predicted Secondary structure 











..



Query SS confidence 
































. .









Query Sequence  MQVLHVCSEMFPLLKTGGLADVIGALPAAQIAD. . GVDARVLLPA
Query Conservation 



 
     
    

       

  
   ..

 
 


  
Alig confidence 





..........
















..









Template Conservation 
 



..........



 

  

  
     
  
    
 
Template Sequence  FSIAVT. . . . . . . . . . GATGQLGGLVIQHLXAAVPASQIIAIVRN
Template Known Secondary structure 

..........STTSS
GGGSS
Template Predicted Secondary structure 
..........










Template SS confidence 












































   1..... ...10.........20.........30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions