Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6U8
Confidence61.66%DateThu Jan 5 11:03:56 GMT 2012
Rank387Aligned Residues30
% Identity23%Templatec2qytA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:2-dehydropantoate 2-reductase; PDBTitle: crystal structure of 2-dehydropantoate 2-reductase from porphyromonas2 gingivalis w83
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.... .....40.
Predicted Secondary structure 












......
Query SS confidence 

































. . . . . .






Query Sequence  MQVLHVCSEMFPLLKTGGLADVIGALPAAQIADG. . . . . . VDARVLL
Query Conservation 



 
     
    

       

  
   
......
 
 


Alig confidence 





...........
















......






Template Conservation 


 

...........





   
  
   
        


  
Template Sequence  IKIAVF. . . . . . . . . . . GLGGVGGYYGAXLALRAAATDGLLEVSWIA
Template Known Secondary structure  ...........

STTSS
Template Predicted Secondary structure 
...........











Template SS confidence 














































   6...10. ........20.........30.........40.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions