Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6U8
Confidence56.66%DateThu Jan 5 11:03:56 GMT 2012
Rank468Aligned Residues30
% Identity17%Templatec2q3eH_
PDB info PDB header:oxidoreductaseChain: H: PDB Molecule:udp-glucose 6-dehydrogenase; PDBTitle: structure of human udp-glucose dehydrogenase complexed with nadh and2 udp-glucose
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.
Predicted Secondary structure 













Query SS confidence 








































Query Sequence  MQVLHVCSEMFPLLKTGGLADVIGALPAAQIADGVDARVLL
Query Conservation 



 
     
    

       

  
   

 
 


Alig confidence 





...........























Template Conservation 





...........


 


  
  

  
    
 
Template Sequence  KKICCI. . . . . . . . . . . GAGYVGGPTCSVIAHMCPEIRVTV
Template Known Secondary structure 
...........

STT
TTS
Template Predicted Secondary structure 
...........






Template SS confidence 








































   5....10 .........20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions