Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6U8
Confidence61.14%DateThu Jan 5 11:03:56 GMT 2012
Rank396Aligned Residues29
% Identity10%Templatec2eq8E_
PDB info PDB header:oxidoreductaseChain: E: PDB Molecule:pyruvate dehydrogenase complex, dihydrolipoamide PDBTitle: crystal structure of lipoamide dehydrogenase from thermus thermophilus2 hb8 with psbdp
Resolution1.94 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1. .......10.........20.........30.........40
Predicted Secondary structure 
...












Query SS confidence 

. . .





































Query Sequence  MQ. . . VLHVCSEMFPLLKTGGLADVIGALPAAQIADGVDARVL
Query Conservation 

...

 
     
    

       

  
   

 
 

Alig confidence 

...



...........






















Template Conservation 

 





...........


 


 

  
   
  
 

Template Sequence  MKTYDLIVI. . . . . . . . . . . GTGPGGYHAAIRAAQLGLKVLAV
Template Known Secondary structure 
...........

STT

Template Predicted Secondary structure 



...........





Template SS confidence 










































   7..10..... ....20.........30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions