Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6U8
Confidence71.41%DateThu Jan 5 11:03:56 GMT 2012
Rank246Aligned Residues29
% Identity17%Templatec1nhqA_
PDB info PDB header:oxidoreductase (h2o2(a))Chain: A: PDB Molecule:nadh peroxidase; PDBTitle: crystallographic analyses of nadh peroxidase cys42ala and cys42ser2 mutants: active site structure, mechanistic implications, and an3 unusual environment of arg303
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30... ......40
Predicted Secondary structure 











..

Query SS confidence 
































. .






Query Sequence  MQVLHVCSEMFPLLKTGGLADVIGALPAAQIAD. . GVDARVL
Query Conservation 



 
     
    

       

  
   ..

 
 

Alig confidence 





...........















..






Template Conservation 





...........


 


 

  
        
 

Template Sequence  MKVIVL. . . . . . . . . . . GSSHGGYEAVEELLNLHPDAEIQWY
Template Known Secondary structure 
...........
SS
TTS
Template Predicted Secondary structure 
...........






Template SS confidence 









































   1..... ...10.........20.........30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions