Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6U8
Confidence89.09%DateThu Jan 5 11:03:56 GMT 2012
Rank118Aligned Residues34
% Identity21%Templatec1i36A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:conserved hypothetical protein mth1747; PDBTitle: structure of conserved protein mth1747 of unknown function2 reveals structural similarity with 3-hydroxyacid3 dehydrogenases
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.....
Predicted Secondary structure 

















Query SS confidence 












































Query Sequence  MQVLHVCSEMFPLLKTGGLADVIGALPAAQIADGVDARVLLPAFP
Query Conservation 



 
     
    

       

  
   

 
 


    
Alig confidence 





...........



























Template Conservation 





...........
 
 

  

  
   
  
        
Template Sequence  LRVGFI. . . . . . . . . . . GFGEVAQTLASRLRSRGVEVVTSLEGRS
Template Known Secondary structure 
...........S
STT


TT

Template Predicted Secondary structure 
...........







Template SS confidence 












































   1..... ...10.........20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions