Return to main results Retrieve Phyre Job Id

Job DescriptionP75884
Confidence2.83%DateThu Jan 5 12:15:36 GMT 2012
Rank83Aligned Residues29
% Identity28%Templatec1zoiC_
PDB info PDB header:hydrolaseChain: C: PDB Molecule:esterase; PDBTitle: crystal structure of a stereoselective esterase from2 pseudomonas putida ifo12996
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   52.......60.........70.........80.........
Predicted Secondary structure 













Query SS confidence 





































Query Sequence  MYLRLNEGQRIFVVLGYIEQEQSKWLSQDNAMLVTHNG
Query Conservation   
  
     
 


   
  
 

 
 
   



 
Alig confidence 













.........














Template Conservation 


   

  
 
 .........  
    
 





Template Sequence  SYVTTKDGVQIFYK. . . . . . . . . DWGPRDAPVIHFHHG
Template Known Secondary structure 

TTS
.........S
TTS


Template Predicted Secondary structure 





.........







Template SS confidence 





































   2.......10..... ....20.........30
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions