Return to main results Retrieve Phyre Job Id

Job DescriptionP05458
Confidence7.70%DateThu Jan 5 10:58:43 GMT 2012
Rank75Aligned Residues28
% Identity18%Templatec4a1cX_
PDB info PDB header:ribosomeChain: X: PDB Molecule:60s ribosomal protein l32; PDBTitle: t.thermophila 60s ribosomal subunit in complex with2 initiation factor 6. this file contains 5s rrna,3 5.8s rrna and proteins of molecule 4.
Resolution3.52 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4950.........60.. .......70......
Predicted Secondary structure 







........





Query SS confidence 













. . . . . . . .













Query Sequence  LDNGMVVLLVSDPQ. . . . . . . . AVKSLSALVVPVGS
Query Conservation 
 


 
 
  
  ........       
 
  

Alig confidence 













........













Template Conservation   


    

 
  


 


        

  

 
Template Sequence  LPNGFKKFLIRNPADLEILLMNNRTYCGEIAHNISA
Template Known Secondary structure 
TTS
SSSTTT
TTS
Template Predicted Secondary structure 













Template SS confidence 



































   6970.........80.........90.........100....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions