Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC55
Confidence8.04%DateThu Jan 5 11:17:13 GMT 2012
Rank79Aligned Residues24
% Identity13%Templated1sqsa_
SCOP infoFlavodoxin-like Flavoproteins Hypothetical protein SP1951
Resolution1.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   66...70.........80.........90......
Predicted Secondary structure 







Query SS confidence 






























Query Sequence  ADDQLDEVIDIVSKAAYTGKIGDGKIFVAEL
Query Conservation   

 

 

  
     

  


 


 

Alig confidence 














.......








Template Conservation    

   
   
  
.......
 


 


Template Sequence  NADDGGVIKKELLES. . . . . . . DIIIISSPV
Template Known Secondary structure  TTST
.......S
Template Predicted Secondary structure 

.......


Template SS confidence 






























   66...70.........80 .........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions