Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC55
Confidence22.43%DateThu Jan 5 11:17:13 GMT 2012
Rank35Aligned Residues58
% Identity10%Templatec2hk3A_
PDB info PDB header:lyaseChain: A: PDB Molecule:diphosphomevalonate decarboxylase; PDBTitle: crystal structure of mevalonate diphosphate decarboxylase2 from staphylococcus aureus (orthorhombic form)
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12.......20.........30.........40.........50.........60.........70.........80.........90.
Predicted Secondary structure 
































Query SS confidence 















































































Query Sequence  KLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKI
Query Conservation      
  

   
  
 

  
 
 
                    
  
 


 

 

 

  
     

  


 
Alig confidence 



















...




.....................



















.....





Template Conservation   
   
      
      
...




.....................
  
        
  

   .....
     
Template Sequence  DVMALVHECREAGYPCYFTM. . . DAGPN. . . . . . . . . . . . . . . . . . . . . VKILVEKKNKQQIIDKLLTQ. . . . . FDNNQI
Template Known Secondary structure  TT


...
SSS
.....................GGGTT.....S
GGG
Template Predicted Secondary structure 



...



.....................
.....



Template SS confidence 















































































   263......270.........280.. ..... ..290.........300....... ..310...
 
   92......
Predicted Secondary structure 
Query SS confidence 






Query Sequence  FVAELQR
Query Conservation 

 

  
Alig confidence 






Template Conservation 
      
Template Sequence  IDSDIIA
Template Known Secondary structure  B

Template Predicted Secondary structure 



Template SS confidence 






   314.....320
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions