Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC55
Confidence7.46%DateThu Jan 5 11:17:13 GMT 2012
Rank87Aligned Residues61
% Identity21%Templatec2hfuB_
PDB info PDB header:transferaseChain: B: PDB Molecule:mevalonate kinase, putative; PDBTitle: crystal structure of l. major mevalonate kinase in complex2 with r-mevalonate
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12.......20.........30.........40.........50.........60.........70.........80.........90.
Predicted Secondary structure 
































Query SS confidence 















































































Query Sequence  KLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKI
Query Conservation      
  

   
  
 

  
 
 
                    
  
 


 

 

 

  
     

  


 
Alig confidence 


















.....





................























....





Template Conservation   
  
       
  



.....



 
................
 
 

         
   
    ....      
Template Sequence  ELESIVQTCRTYGALGAKL. . . . . SGTGRG. . . . . . . . . . . . . . . . GIAVALAASSDQRDAIVKGLKAKC. . . . PEAKFI
Template Known Secondary structure  TT
S.....SS
SS................SSS
....TT

Template Predicted Secondary structure 



.....





................


....


Template SS confidence 















































































   262.......270.........280 ...... ...290.........300.........310 ......
 
   92.....
Predicted Secondary structure 
Query SS confidence 





Query Sequence  FVAELQ
Query Conservation 

 

 
Alig confidence 





Template Conservation        
Template Sequence  WRYTVQ
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 





   317..320..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions