Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC55
Confidence8.42%DateThu Jan 5 11:17:13 GMT 2012
Rank71Aligned Residues59
% Identity17%Templatec2gs8A_
PDB info PDB header:lyaseChain: A: PDB Molecule:mevalonate pyrophosphate decarboxylase; PDBTitle: structure of mevalonate pyrophosphate decarboxylase from streptococcus2 pyogenes
Resolution1.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12.......20.........30.........40.........50.........60.........70.........80.........90.
Predicted Secondary structure 
































Query SS confidence 















































































Query Sequence  KLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKI
Query Conservation      
  

   
  
 

  
 
 
                    
  
 


 

 

 

  
     

  


 
Alig confidence 

















...






.....................




















........

Template Conservation   
  
       

  
 ... 





.....................
  
        
   
    ........  
Template Sequence  QAXEAVKELRQEGFACYF. . . TXDAGPN. . . . . . . . . . . . . . . . . . . . . VKVLCLEKDLAQLAERLGKNY. . . . . . . . RI
Template Known Secondary structure  TT

...

SSS
.....................GGGTTS........
Template Predicted Secondary structure 


...



.....................


........
Template SS confidence 















































































   256...260.........270... ......280 .........290.........300. ..
 
   92.......100..
Predicted Secondary structure 

Query SS confidence 










Query Sequence  FVAELQRVIRI
Query Conservation 

 

   
 
Alig confidence 










Template Conservation 
      
   
Template Sequence  IVSKTKDLPDV
Template Known Secondary structure  B





Template Predicted Secondary structure 







Template SS confidence 










   304.....310....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions