Return to main results Retrieve Phyre Job Id

Job DescriptionP56580
Confidence6.49%DateThu Jan 5 12:06:25 GMT 2012
Rank65Aligned Residues19
% Identity32%Templatec2nrhA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:transcriptional activator, putative, baf family; PDBTitle: crystal structure of conserved putative baf family2 transcriptional activator from campylobacter jejuni
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3940.........50.........60.........70..
Predicted Secondary structure 

















Query SS confidence 

































Query Sequence  VDKLAQLTGWQAIDGFKEGEPAEAEIGVAVIDCG
Query Conservation 
 


 


   




   
 
 

  





Alig confidence 











...............






Template Conservation   

     

  ............... 



 
Template Sequence  IDRIAACYTIED. . . . . . . . . . . . . . . GVVVDAG
Template Known Secondary structure  TT
SS...............SS
Template Predicted Secondary structure 



...............

Template SS confidence 

































   73......80.... .....90.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions