Return to main results Retrieve Phyre Job Id

Job DescriptionP56580
Confidence5.01%DateThu Jan 5 12:06:25 GMT 2012
Rank87Aligned Residues28
% Identity43%Templatec1f13A_
PDB info PDB header:coagulation factorChain: A: PDB Molecule:cellular coagulation factor xiii zymogen; PDBTitle: recombinant human cellular coagulation factor xiii
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.........70.........80......
Predicted Secondary structure 


























Query SS confidence 







































Query Sequence  GWQAIDGFKEGEPAEAEIGVAVIDCGGTLRCGIYPKRRIP
Query Conservation 
   




   
 
 

  
















 

Alig confidence 





....





........















Template Conservation 





....




 ........
 
 
 





 


Template Sequence  GWQAVD. . . . STPQEN. . . . . . . . SDGMYRCGPASVQAIK
Template Known Secondary structure  ............TT
Template Predicted Secondary structure 
....





........



Template SS confidence 







































   391..... ...400.. .......410........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions