Return to main results Retrieve Phyre Job Id

Job DescriptionP07010
Confidence2.73%DateThu Jan 5 10:59:57 GMT 2012
Rank86Aligned Residues45
% Identity27%Templatec3kalB_
PDB info PDB header:ligaseChain: B: PDB Molecule:homoglutathione synthetase; PDBTitle: structure of homoglutathione synthetase from glycine max in2 closed conformation with homoglutathione, adp, a sulfate3 ion, and three magnesium ions bound
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40.........50.........60.........70.........80.
Predicted Secondary structure 



















Query SS confidence 




































































Query Sequence  EDGLYAVCVENGNLVSHYRIMCLRKNGAALINFVDARVTDGFILREGEFVTSLQALKEIGIKAGFSAFS
Query Conservation 




































































Alig confidence 


















...................






.....


















Template Conservation 





  
     
  
 ...................  




.....

     






   

Template Sequence  EAGIFGTYLRNKDKIIINN. . . . . . . . . . . . . . . . . . . ESGYMVR. . . . . TKISSSYEGGVLPGFGVVD
Template Known Secondary structure  SSS
........................TT
S


TTTTS
Template Predicted Secondary structure 





...................


.....











Template SS confidence 




































































   450.........460........ .470..... ....480.........490....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions