Return to main results Retrieve Phyre Job Id

Job DescriptionP07010
Confidence2.82%DateThu Jan 5 10:59:57 GMT 2012
Rank82Aligned Residues44
% Identity27%Templatec2hgsA_
PDB info PDB header:amine/carboxylate ligaseChain: A: PDB Molecule:protein (glutathione synthetase); PDBTitle: human glutathione synthetase
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40.........50.........60.........70.........80
Predicted Secondary structure 


















Query SS confidence 



































































Query Sequence  EDGLYAVCVENGNLVSHYRIMCLRKNGAALINFVDARVTDGFILREGEFVTSLQALKEIGIKAGFSAF
Query Conservation 



































































Alig confidence 


















...................






.....

















Template Conservation 





  
     
  
 ...................  




.....

   
 






   
Template Sequence  ELGIFGVYVRQEKTLVMNK. . . . . . . . . . . . . . . . . . . HVGHLLR. . . . . TKAIEHADGGVAAGVAVL
Template Known Secondary structure  TT........................TT
SS

TTTTS
Template Predicted Secondary structure 


...................


.....









Template SS confidence 



































































   425....430.........440... ......450 .........460........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions