Return to main results Retrieve Phyre Job Id

Job DescriptionP07010
Confidence12.13%DateThu Jan 5 10:59:57 GMT 2012
Rank14Aligned Residues43
% Identity33%Templatec1k9aB_
PDB info PDB header:transferaseChain: B: PDB Molecule:carboxyl-terminal src kinase; PDBTitle: crystal structure analysis of full-length carboxyl-terminal2 src kinase at 2.5 a resolution
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40.........50.........60.........70
Predicted Secondary structure 













Query SS confidence 

























































Query Sequence  EDGLYAVCVENGNLVSHYRIMCLRKNGAALINFVDARVTDGFILREGEFVTSLQALKE
Query Conservation 

























































Alig confidence 






















...............



















Template Conservation    
 
 


     
 
  
   ...............     
     
 

  

 
Template Sequence  YPGDYTLCVSCEGKVEHYRIMYH. . . . . . . . . . . . . . . ASKLSIDEEVYFENLMQLVE
Template Known Secondary structure  STT
TT...............TTSSSSS
BSS
Template Predicted Secondary structure 






...............









Template SS confidence 

























































   112.......120.........130.... .....140.........150....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions