Return to main results Retrieve Phyre Job Id

Job DescriptionP56259
Confidence8.58%DateThu Jan 5 12:06:21 GMT 2012
Rank28Aligned Residues22
% Identity5%Templatec3nahC_
PDB info PDB header:transferaseChain: C: PDB Molecule:rna dependent rna polymerase; PDBTitle: crystal structures and functional analysis of murine norovirus rna-2 dependent rna polymerase
Resolution2.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40..
Predicted Secondary structure 


























Query SS confidence 


































Query Sequence  KVGEILECNFGNYPVSQNGPFSTTYYDGRIPPEMI
Query Conservation 
 
 

 


            
    
 
 


 
Alig confidence 












.............








Template Conservation          


 
.............
 

   
 
Template Sequence  NFRYHMDADYTRW. . . . . . . . . . . . . DSTQQRAIL
Template Known Secondary structure  TSS



SS
.............GGG

Template Predicted Secondary structure 







.............




Template SS confidence 


































   237..240......... 250........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions