Return to main results Retrieve Phyre Job Id

Job DescriptionP56259
Confidence3.62%DateThu Jan 5 12:06:21 GMT 2012
Rank77Aligned Residues19
% Identity32%Templatec3n6mA_
PDB info PDB header:transferaseChain: A: PDB Molecule:rna-dependent rna polymerase; PDBTitle: crystal structure of ev71 rdrp in complex with gtp
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.........30.........40.
Predicted Secondary structure 
























Query SS confidence 































Query Sequence  GEILECNFGNYPVSQNGPFSTTYYDGRIPPEM
Query Conservation 
 

 


            
    
 
 


Alig confidence 










.............







Template Conservation        


 
.............


    
Template Sequence  GSLFAFDYSGY. . . . . . . . . . . . . DASLSPVW
Template Known Secondary structure  S
S.............

Template Predicted Secondary structure 

.............




Template SS confidence 































   227..230....... ..240.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions