Return to main results Retrieve Phyre Job Id

Job DescriptionP56259
Confidence3.87%DateThu Jan 5 12:06:21 GMT 2012
Rank74Aligned Residues28
% Identity25%Templatec2j0kB_
PDB info PDB header:transferaseChain: B: PDB Molecule:focal adhesion kinase 1; PDBTitle: crystal structure of a fragment of focal adhesion kinase2 containing the ferm and kinase domains.
Resolution3.0 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30.........40......
Predicted Secondary structure 

























Query SS confidence 





































Query Sequence  VGEILECNFGNYPVSQNGPFSTTYYDGRIPPEMIKNRL
Query Conservation   
 

 


            
    
 
 


 
 

Alig confidence 









..........

















Template Conservation      

 


..........


  
   


 
    
Template Sequence  TDCVKLGDFG. . . . . . . . . . LSRLPIKWMAPESINFRR
Template Known Secondary structure  TT



..........




GGG



Template Predicted Secondary structure 





..........









Template SS confidence 





































   557..560...... ...570.........580....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions