Return to main results Retrieve Phyre Job Id

Job DescriptionP58036
Confidence11.16%DateThu Jan 5 12:06:34 GMT 2012
Rank1Aligned Residues24
% Identity38%Templatec3fcnA_
PDB info PDB header:unknown functionChain: A: PDB Molecule:an alpha-helical protein of unknown function (pfam01724); PDBTitle: crystal structure of an alpha-helical protein of unknown function2 (rru_a3208) from rhodospirillum rubrum atcc 11170 at 1.45 a3 resolution
Resolution1.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   27..30.........40.. .... ...50
Predicted Secondary structure 
..........
Query SS confidence 















. .



. . . . . . . .



Query Sequence  SYAKDFFLYIETQLKI. . AKDF. . . . . . . . LDLE
Query Conservation 















..



........



Alig confidence 















..



........



Template Conservation   

 

  
   

 


   
        

 
Template Sequence  TYEADLFVWCQQQADGLRALSRSRRDLPDDLDLE
Template Known Secondary structure 
TTT

SSS
TT

Template Predicted Secondary structure 









Template SS confidence 

































   7..10.........20.........30.........40
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions