Return to main results Retrieve Phyre Job Id

Job DescriptionP31545
Confidence6.94%DateThu Jan 5 11:48:05 GMT 2012
Rank51Aligned Residues45
% Identity20%Templatec2vfyA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:akap18 delta; PDBTitle: akap18 delta central domain
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   73......80. ........90.........100.........110.........120.........130........
Predicted Secondary structure 


.




























Query SS confidence 








.
























































Query Sequence  MLVAFDVLA. SDKADLERLFRLLTQRFAFLTQGGAAPETPNPRLPPLDSGILGGYIAPDNLTITLSV
Query Conservation     



  .     
  

   
     
  
               

       

 





 
Alig confidence 








.














..............








.......











Template Conservation 






    
       
  
  ..............         .......
    




  
Template Sequence  YFLSIPITNKKITAGIKVLQNSILR. . . . . . . . . . . . . . QDNRLTKAM. . . . . . . VGDGSFHITLLV
Template Known Secondary structure 


..............
GGGGGGB.......

TT

Template Predicted Secondary structure 


..............







.......

Template SS confidence 


































































   92.......100.........110...... ...120..... ....130.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions