Return to main results Retrieve Phyre Job Id

Job DescriptionP31545
Confidence4.51%DateThu Jan 5 11:48:05 GMT 2012
Rank75Aligned Residues30
% Identity30%Templatec2knrA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein atc0905; PDBTitle: solution structure of protein atu0922 from a. tumefaciens. northeast2 structural genomics consortium target att13. ontario center for3 structural proteomics target atc0905
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   327..330.........340.........350.........360.........370
Predicted Secondary structure 


























Query SS confidence 











































Query Sequence  DSHIRLANPRTAESESSLMLRRGYSYSLGVTNSGQLDMGLLFVC
Query Conservation   





 

        



  

       
  
 

 


Alig confidence 







...











...........









Template Conservation   




  ...  
  
 
 


...........
 







Template Sequence  SALIRRVF. . . AAGGFAAVEKKG. . . . . . . . . . . AEAAGAIFVR
Template Known Secondary structure  ...TT


...........
TTT

Template Predicted Secondary structure  ...





...........




Template SS confidence 











































   10....... ..20......... 30.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions