Return to main results Retrieve Phyre Job Id

Job DescriptionP31545
Confidence6.89%DateThu Jan 5 11:48:05 GMT 2012
Rank52Aligned Residues31
% Identity19%Templatec1nmlA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:di-haem cytochrome c peroxidase; PDBTitle: di-haemic cytochrome c peroxidase from pseudomonas nautica 617, form2 in (ph 4.0)
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   52.......60.........70.........80.........90.....
Predicted Secondary structure 
























Query SS confidence 











































Query Sequence  EKQPFYGEHQAGILTPQQAAMMLVAFDVLASDKADLERLFRLLT
Query Conservation     

 
 




 

 
      



       
  

   
Alig confidence 











.............


















Template Conservation 


         .............  

  
   




 


Template Sequence  EAVAVMGTAQLG. . . . . . . . . . . . . TELNNDEVKSIVAFLKTLT
Template Known Secondary structure  T

TTTT.............



GGG
Template Predicted Secondary structure 





.............





Template SS confidence 











































   270.........280. ........290.........300
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions