Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8S1
Confidence86.07%DateThu Jan 5 11:08:37 GMT 2012
Rank185Aligned Residues24
% Identity25%Templated1lcda_
SCOP infolambda repressor-like DNA-binding domains lambda repressor-like DNA-binding domains GalR/LacI-like bacterial regulator
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........
Predicted Secondary structure 









Query SS confidence 






































Query Sequence  MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRI
Query Conservation 
   

  
  
  
   

 
 

  
 






  
Alig confidence 








...............














Template Conservation 

  

 

...............
  



 




 
Template Sequence  MKPVTLYDV. . . . . . . . . . . . . . . AEYAGVSYQTVSRVV
Template Known Secondary structure 




...............TS
Template Predicted Secondary structure 




...............


Template SS confidence 






































   1........ 10.........20....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions