Return to main results Retrieve Phyre Job Id

Job DescriptionP69853
Confidence4.07%DateThu Jan 5 12:12:13 GMT 2012
Rank42Aligned Residues33
% Identity21%Templated1bxla_
SCOP infoToxins' membrane translocation domains Bcl-2 inhibitors of programmed cell death Bcl-2 inhibitors of programmed cell death
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   127..130......... 140......... 150.........
Predicted Secondary structure  ....



.......
Query SS confidence 












. . . .









. . . . . . .









Query Sequence  HFGSLLLMAAWLA. . . . ENGRQTECEE. . . . . . . LLAWHLFPWS
Query Conservation 

  

 


 
 ....          .......

  

  
 
Alig confidence 












....









.......









Template Conservation 





 
 
 

           
  
      

   
  

Template Sequence  RIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWI
Template Known Secondary structure  TT
TS
Template Predicted Secondary structure 


Template SS confidence 











































   139140.........150.........160.........170.........180..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions