Return to main results Retrieve Phyre Job Id

Job DescriptionP69853
Confidence7.19%DateThu Jan 5 12:12:13 GMT 2012
Rank15Aligned Residues33
% Identity12%Templatec3qbrA_
PDB info PDB header:apoptosisChain: A: PDB Molecule:sjchgc06286 protein; PDBTitle: bakbh3 in complex with sja
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   127..130......... 140........ .150.........
Predicted Secondary structure  ....



.......
Query SS confidence 












. . . .








. . . . . . .










Query Sequence  HFGSLLLMAAWLA. . . . ENGRQTECE. . . . . . . ELLAWHLFPWS
Query Conservation 

  

 


 
 ....         ....... 

  

  
 
Alig confidence 












....








.......










Template Conservation 







 
 

      
    
  
  
   

   
  

Template Sequence  RIVAMFAFLRILVLRLSKHGHSDAIQMLIKTTSQYSDEKLKNWI
Template Known Secondary structure  TTT
T
Template Predicted Secondary structure 


Template SS confidence 











































   111........120.........130.........140.........150....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions