Return to main results Retrieve Phyre Job Id

Job DescriptionP0A959
Confidence26.81%DateThu Jan 5 11:09:27 GMT 2012
Rank366Aligned Residues47
% Identity19%Templatec3jugA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:beta-mannanase; PDBTitle: crystal structure of endo-beta-1,4-mannanase from the alkaliphilic2 bacillus sp. n16-5
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   133......140.........150.........160.........170.........180.........190.........200.......
Predicted Secondary structure 

































Query SS confidence 










































































Query Sequence  TAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFAD
Query Conservation         
                                      



          
   
      

 
Alig confidence 

























............................




















Template Conservation 
  

  
 
 


            ............................   

  
  
   

 



Template Sequence  IPAIAEQGANTIRIVLSDGGQWEKDD. . . . . . . . . . . . . . . . . . . . . . . . . . . . IDTVREVIELAEQNKMVAVVE
Template Known Secondary structure  TT
S

SSSS



............................TTT
Template Predicted Secondary structure 












............................



Template SS confidence 










































































   71........80.........90...... ...100.........110.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions