Return to main results Retrieve Phyre Job Id

Job DescriptionP00968
Confidence89.77%DateThu Jan 5 10:57:25 GMT 2012
Rank461Aligned Residues34
% Identity32%Templatec3qj4A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:renalase; PDBTitle: crystal structure of human renalase (isoform 1)
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40. ........50.
Predicted Secondary structure 






















..



Query SS confidence 








































. .









Query Sequence  MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEG. . YRVILVNSNP
Query Conservation 

    









 
 

 
 


 

 







 
..
 



  

Alig confidence 

......







...........













..









Template Conservation 
 ......

 




........... 


  
  
   
    
 
 
   
Template Sequence  MA. . . . . . QVLIVGAG. . . . . . . . . . . MTGSLCAALLRRQTGPLYLAVWDKAD
Template Known Secondary structure 
......

S...........S




SSS
Template Predicted Secondary structure 

......



...........







Template SS confidence 




















































   1. .......10 .........20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions