Return to main results Retrieve Phyre Job Id

Job DescriptionP00968
Confidence91.67%DateThu Jan 5 10:57:25 GMT 2012
Rank342Aligned Residues33
% Identity36%Templatec3nksA_
PDB info PDB header:oxidoreductase/oxidoreductase inhibitorChain: A: PDB Molecule:protoporphyrinogen oxidase; PDBTitle: structure of human protoporphyrinogen ix oxidase
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40. ........50.
Predicted Secondary structure 















..



Query SS confidence 

































. .









Query Sequence  KSILILGAGPIVIGQACEFDYSGAQACKALREEG. . YRVILVNSNP
Query Conservation 








 
 

 
 


 

 







 
..
 



  

Alig confidence 








...........













..









Template Conservation 


 




........... 


 

  
   
    
 



  
Template Sequence  RTVVVLGGG. . . . . . . . . . . ISGLAASYHLSRAPCPPKVVLVESSE
Template Known Secondary structure 


B...........TSSS


SSS
Template Predicted Secondary structure 



...........







Template SS confidence 













































   3......10. ........20.........30.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions