Return to main results Retrieve Phyre Job Id

Job DescriptionP00968
Confidence94.19%DateThu Jan 5 10:57:25 GMT 2012
Rank204Aligned Residues33
% Identity24%Templatec3kd9B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:coenzyme a disulfide reductase; PDBTitle: crystal structure of pyridine nucleotide disulfide oxidoreductase from2 pyrococcus horikoshii
Resolution2.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40 .........50.
Predicted Secondary structure 














..




Query SS confidence 
































. .










Query Sequence  KSILILGAGPIVIGQACEFDYSGAQACKALREE. . GYRVILVNSNP
Query Conservation 








 
 

 
 


 

 







 ..

 



  

Alig confidence 








...........












..










Template Conservation 








........... 


 

  
        
 


   
Template Sequence  KKVVIIGGG. . . . . . . . . . . AAGMSAASRVKRLKPEWDVKVFEATE
Template Known Secondary structure 


S...........
TTSSSS
Template Predicted Secondary structure 



...........






Template SS confidence 













































   4.....10.. .......20.........30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions