Return to main results Retrieve Phyre Job Id

Job DescriptionP00968
Confidence92.28%DateThu Jan 5 10:57:25 GMT 2012
Rank299Aligned Residues32
% Identity22%Templatec3h8lA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:nadh oxidase; PDBTitle: the first x-ray structure of a sulfide:quinone2 oxidoreductase: insights into sulfide oxidation mechanism
Resolution2.57 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30.........40 .........50.
Predicted Secondary structure 













...




Query SS confidence 































. . .










Query Sequence  SILILGAGPIVIGQACEFDYSGAQACKALREE. . . GYRVILVNSNP
Query Conservation 







 
 

 
 


 

 







 ...

 



  

Alig confidence 







...........












...










Template Conservation 







...........



 

  
      
  
 



  
Template Sequence  KVLVLGGR. . . . . . . . . . . FGALTAAYTLKRLVGSKADVKVINKSR
Template Known Secondary structure 
SS...........GGGSSSS
Template Predicted Secondary structure 


...........








Template SS confidence 













































   3......10 .........20.........30.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions