Return to main results Retrieve Phyre Job Id

Job DescriptionP00968
Confidence94.97%DateThu Jan 5 10:57:25 GMT 2012
Rank168Aligned Residues45
% Identity22%Templatec2ydyA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:methionine adenosyltransferase 2 subunit beta; PDBTitle: crystal structure of human s-adenosylmethionine synthetase2 2, beta subunit in orthorhombic crystal form
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40.........50.........60.........70.........80.......
Predicted Secondary structure 

































Query SS confidence 















































































Query Sequence  KSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVILVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVL
Query Conservation 








 
 

 
 


 

 







 

 



  

 

 
    

  

 

  
 
  

  
 




Alig confidence 









..........






















.........................











Template Conservation 









.......... 

  
   
   
  
    
 .........................  
     
 

Template Sequence  RRVLVTGATG. . . . . . . . . . LLGRAVHKEFQQNNWHAVGCGVH. . . . . . . . . . . . . . . . . . . . . . . . . HIIHDFQPHVIV
Template Known Secondary structure 
TTTS..........TTT


.........................

S
Template Predicted Secondary structure 




..........


.........................



Template SS confidence 















































































   2930........ .40.........50.........60. ........70...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions