Return to main results Retrieve Phyre Job Id

Job DescriptionP00968
Confidence91.63%DateThu Jan 5 10:57:25 GMT 2012
Rank344Aligned Residues32
% Identity38%Templatec2weuD_
PDB info PDB header:antifungal proteinChain: D: PDB Molecule:tryptophan 5-halogenase; PDBTitle: crystal structure of tryptophan 5-halogenase (pyrh) complex2 with substrate tryptophan
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30.........40 .........
Predicted Secondary structure 















...



Query SS confidence 

































. . .








Query Sequence  IKSILILGAGPIVIGQACEFDYSGAQACKALREE. . . GYRVILVNS
Query Conservation 









 
 

 
 


 

 







 ...

 



  
Alig confidence 









...........












...








Template Conservation 

 






........... 

  

  


    
  




 
Template Sequence  IRSVVIVGGG. . . . . . . . . . . TAGWMTASYLKAAFDDRIDVTLVES
Template Known Secondary structure 



...........GGGS
Template Predicted Secondary structure 



...........




Template SS confidence 













































   2.......10. ........20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions