Return to main results Retrieve Phyre Job Id

Job DescriptionP00968
Confidence89.45%DateThu Jan 5 10:57:25 GMT 2012
Rank479Aligned Residues32
% Identity44%Templatec2rgjA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:flavin-containing monooxygenase; PDBTitle: crystal structure of flavin-containing monooxygenase phzs
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30.........40.. .......50.
Predicted Secondary structure 















.


Query SS confidence 

































.








Query Sequence  SILILGAGPIVIGQACEFDYSGAQACKALREEGY. RVILVNSNP
Query Conservation 







 
 

 
 


 

 







 

. 



  

Alig confidence 







...........














.








Template Conservation 

 




........... 


  
  

  
   
 
 

  
Template Sequence  DILIAGAG. . . . . . . . . . . IGGLSCALALHQAGIGKVTLLESSS
Template Known Secondary structure 

S...........TT

SSS
Template Predicted Secondary structure 


...........






Template SS confidence 











































   6...10... ......20.........30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions