Return to main results Retrieve Phyre Job Id

Job DescriptionP00968
Confidence92.66%DateThu Jan 5 10:57:25 GMT 2012
Rank280Aligned Residues34
% Identity26%Templatec2p4hX_
PDB info PDB header:plant proteinChain: X: PDB Molecule:vestitone reductase; PDBTitle: crystal structure of vestitone reductase from alfalfa2 (medicago sativa l.)
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40.........50.
Predicted Secondary structure 



















Query SS confidence 











































Query Sequence  KSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVILVNSNP
Query Conservation 








 
 

 
 


 

 







 

 



  

Alig confidence 









..........























Template Conservation   








..........


  
   
   
  
    
  
Template Sequence  GRVCVTGGTG. . . . . . . . . . FLGSWIIKSLLENGYSVNTTIRAD
Template Known Secondary structure 
STTS..........TT




Template Predicted Secondary structure 




..........





Template SS confidence 











































   6...10..... ....20.........30.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions