Return to main results Retrieve Phyre Job Id

Job DescriptionP00968
Confidence89.86%DateThu Jan 5 10:57:25 GMT 2012
Rank455Aligned Residues31
% Identity42%Templatec2e5vA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:l-aspartate oxidase; PDBTitle: crystal structure of l-aspartate oxidase from2 hyperthermophilic archaeon sulfolobus tokodaii
Resolution2.09 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.........30.........40.........50.
Predicted Secondary structure 


















Query SS confidence 









































Query Sequence  ILILGAGPIVIGQACEFDYSGAQACKALREEGYRVILVNSNP
Query Conservation 






 
 

 
 


 

 







 

 



  

Alig confidence 






...........























Template Conservation 






........... 


 

  

  
  
 



  
Template Sequence  IYIIGSG. . . . . . . . . . . IAGLSAGVALRRAGKKVTLISKRI
Template Known Secondary structure 

S...........TT


SST
Template Predicted Secondary structure 


...........






Template SS confidence 









































   2...... .10.........20.........30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions