Return to main results Retrieve Phyre Job Id

Job DescriptionP00968
Confidence91.63%DateThu Jan 5 10:57:25 GMT 2012
Rank343Aligned Residues33
% Identity30%Templatec1xdiA_
PDB info PDB header:unknown functionChain: A: PDB Molecule:rv3303c-lpda; PDBTitle: crystal structure of lpda (rv3303c) from mycobacterium tuberculosis
Resolution2.81 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40 .........50.
Predicted Secondary structure 














...




Query SS confidence 
































. . .










Query Sequence  KSILILGAGPIVIGQACEFDYSGAQACKALREE. . . GYRVILVNSNP
Query Conservation 








 
 

 
 


 

 







 ...

 



  

Alig confidence 








...........












...










Template Conservation   







........... 





  


    
  




   
Template Sequence  TRIVILGGG. . . . . . . . . . . PAGYEAALVAATSHPETTQVTVIDCDG
Template Known Secondary structure 

S...........
TTTSS
Template Predicted Secondary structure 



...........








Template SS confidence 














































   3......10. ........20.........30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions