Return to main results Retrieve Phyre Job Id

Job DescriptionP00968
Confidence92.90%DateThu Jan 5 10:57:25 GMT 2012
Rank266Aligned Residues32
% Identity16%Templatec1nhqA_
PDB info PDB header:oxidoreductase (h2o2(a))Chain: A: PDB Molecule:nadh peroxidase; PDBTitle: crystallographic analyses of nadh peroxidase cys42ala and cys42ser2 mutants: active site structure, mechanistic implications, and an3 unusual environment of arg303
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30.........40 .........50.
Predicted Secondary structure 













..




Query SS confidence 































. .










Query Sequence  SILILGAGPIVIGQACEFDYSGAQACKALREE. . GYRVILVNSNP
Query Conservation 







 
 

 
 


 

 







 ..

 



  

Alig confidence 







...........












..










Template Conservation 







........... 


 

  
        
 


   
Template Sequence  KVIVLGSS. . . . . . . . . . . HGGYEAVEELLNLHPDAEIQWYEKGD
Template Known Secondary structure 
SS...........
TTSSSS
Template Predicted Secondary structure 


...........






Template SS confidence 












































   2....... 10.........20.........30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions